PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0011000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 571aa    MW: 62676 Da    PI: 7.1962
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0011000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.37.1e-103634001954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+  +++ LAk++gL+ +qV++WF N R +
  Spipo23G0011000 363 FEHflHPYPTDMDKQMLAKQTGLSRNQVSNWFINARVR 400
                      554458******************************88 PP

2BELL96.62.1e-31231299472
             BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e ++ k++L+s+leeV++rY+ y +q+q+vi sFeavagl+ a+pYt lA +++S+hFrcLk+ai++q+
  Spipo23G0011000 231 EQRRMKTRLVSMLEEVYRRYRLYFQQIQAVITSFEAVAGLNMAAPYTPLAVRTLSKHFRCLKEAISNQL 299
                      567789************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-39168297IPR006563POX domain
PfamPF075261.3E-33173296IPR006563POX domain
PROSITE profilePS5007112.26341404IPR001356Homeobox domain
SMARTSM003892.3E-10344408IPR001356Homeobox domain
CDDcd000861.07E-12344405No hitNo description
SuperFamilySSF466897.27E-17345410IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-27347408IPR009057Homeodomain-like
PfamPF059205.6E-19361400IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MSESYPGGEG QHQQVMVDGV ATAGGVCLPF YHVPQQCRRE KLRYPNANDS PPLHPHTSTA  60
SPPSFFHYQP STATSFTFPC SSSYHMLNTG SSPSATYEYG TSSAFNLLDH HSLFDGSAHH  120
QQTHGVSLSL SSSVASPSHH PHQEHLIGTA SLGCAPVRME PVPAGPFTGY ATILKGSRFL  180
RPAQQMLEEV CGGGSAGGLA GDNGDEVQPL DFAAEGVAEA DRNLDGSISG EQRRMKTRLV  240
SMLEEVYRRY RLYFQQIQAV ITSFEAVAGL NMAAPYTPLA VRTLSKHFRC LKEAISNQLR  300
FINESFGKDG QRKDEISGHK FMTGGFGYQR AASGSAQINQ QPAWRPQRGL PERAVAVLRG  360
WLFEHFLHPY PTDMDKQMLA KQTGLSRNQV SNWFINARVR LWKPMVEEIH SLELRRKVSD  420
SDDNRNSSKQ PDLSSSSFAS PVNDQTRPSS SSQKNPEQLP HKRFQNELAD IAGHVQEPVN  480
FSLENLPSSH HRLDVPMGGV AAGGGHGGVS LTLGLHQNNG YCLSEQLPLN VVRRFGLEES  540
NVAYVMGGFE GQERQFGKEF DGQLLRDFVA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B7e-16350407158Homeobox protein Meis1
4xrs_A7e-16350407158Homeobox protein Meis1
4xrm_B8e-16350408563Homeobox protein Meis2
4xrm_A8e-16350408563Homeobox protein Meis2
5bng_A8e-16350408159Homeobox protein Meis2
5bng_B8e-16350408159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008801354.11e-148PREDICTED: BEL1-like homeodomain protein 9
TrEMBLB9SV361e-136B9SV36_RICCO; Bel1 homeotic protein, putative
STRINGVIT_08s0007g01290.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-80TALE family protein